PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe7G132200.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family TALE
Protein Properties Length: 601aa    MW: 66556 Da    PI: 6.6524
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe7G132200.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.61e-085195571854
                        HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
           Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                        +F++  ++yp+ +e+  LA++ gLt +qV++WF N R +
  Aqcoe7G132200.2.p 519 MFQNflHPYPKDAEKHILAARSGLTRSQVSNWFINARVR 557
                        7897789******************************88 PP

2BELL74.91.2e-24393463172
               BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                        +rq +++kka+Ll ll+ Vd +Y+q+ ++++tv+s F+a+++l++ + +t++Al++iS  +++L+++ia+qi
  Aqcoe7G132200.2.p 393 QRQSVESKKAQLLILLQAVDTKYNQCFDEIHTVVSTFNAATELDP-QTHTRFALNTISLLYKSLRQRIANQI 463
                        68999****************************************.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.6E-21319461IPR006563POX domain
PfamPF075264.1E-27325460IPR006563POX domain
PROSITE profilePS5007111.402498561IPR001356Homeobox domain
SMARTSM003892.6E-5501565IPR001356Homeobox domain
CDDcd000868.94E-11501561No hitNo description
SuperFamilySSF466891.92E-15501570IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-24504567IPR009057Homeodomain-like
PfamPF059201.9E-15518557IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 601 aa     Download sequence    Send to blast
MDNDIFSNSL DIANRNPLGI DGMFSHMYSG SLVQPDPYDL NSRTQAMAAL PILSTFHGEP  60
TNDLNIEDVN AMENTEASFS RNRPLSRQVL GDSSVGSSSS IANCNFQDYF LRGESLSATS  120
IAHLLSANTN LHGNIRGINV STASGSALGE FRSPAPNGCC STSTSSLATP VSCGYAVRGN  180
MDVLETNKGT SSTGQLDSRW GYGGLLRPQE LTGKSHIQAV CPPHRFIGSS GQHELDASNT  240
SNTSLNHTYG YYIPNSELSL SLATCQPSLT NVSTVLDQSS ELSCSVVTEH SLRGIGLGSE  300
RFSDNRNGLS LNLSYYKPVH FSHLLSGSKY LNVVQQILTN VANYSLENVE YQGGFRENAS  360
NPSYSSNWRE DRITIAVGSD EPYSSVESRP ILQRQSVESK KAQLLILLQA VDTKYNQCFD  420
EIHTVVSTFN AATELDPQTH TRFALNTISL LYKSLRQRIA NQIMMIGEAL NNCMKEDRSF  480
ESSFIQRQWA LQQLRKDHPS WRPQRGLPEK SVSVLREWMF QNFLHPYPKD AEKHILAARS  540
GLTRSQVSNW FINARVRLWK PLIEEMYIEM NNRKSQADEN GSGSDCRSHV SIDNQGFRLN  600
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010267005.10.0PREDICTED: uncharacterized protein LOC104604402
RefseqXP_010267006.10.0PREDICTED: uncharacterized protein LOC104604402
RefseqXP_010267007.10.0PREDICTED: uncharacterized protein LOC104604402
RefseqXP_010267008.10.0PREDICTED: uncharacterized protein LOC104604402
SwissprotP487313e-95ATH1_ARATH; Homeobox protein ATH1
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.13e-96homeobox gene 1